Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2486247..2486885 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M5T36_RS12095 | Protein ID | WP_000813794.1 |
Coordinates | 2486709..2486885 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M5T36_RS12090 | Protein ID | WP_001270285.1 |
Coordinates | 2486247..2486663 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS12070 (2481399) | 2481399..2482340 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
M5T36_RS12075 (2482341) | 2482341..2483354 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
M5T36_RS12080 (2483372) | 2483372..2484517 | - | 1146 | WP_000034363.1 | ABC transporter substrate-binding protein | - |
M5T36_RS12085 (2484762) | 2484762..2486168 | - | 1407 | WP_000760590.1 | PLP-dependent aminotransferase family protein | - |
M5T36_RS12090 (2486247) | 2486247..2486663 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M5T36_RS12095 (2486709) | 2486709..2486885 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M5T36_RS12100 (2487107) | 2487107..2487337 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M5T36_RS12105 (2487429) | 2487429..2489390 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M5T36_RS12110 (2489463) | 2489463..2489999 | - | 537 | WP_000429153.1 | DNA-binding transcriptional regulator SutR | - |
M5T36_RS12115 (2490091) | 2490091..2491266 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2491306..2492454 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T255882 WP_000813794.1 NZ_CP103623:c2486885-2486709 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT255882 WP_001270285.1 NZ_CP103623:c2486663-2486247 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|