Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1346096..1346721 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | M5T36_RS06585 | Protein ID | WP_000911329.1 |
Coordinates | 1346323..1346721 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | M5T36_RS06580 | Protein ID | WP_000450524.1 |
Coordinates | 1346096..1346323 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS06555 (1341898) | 1341898..1342368 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
M5T36_RS06560 (1342368) | 1342368..1342940 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
M5T36_RS06565 (1343086) | 1343086..1343964 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M5T36_RS06570 (1343981) | 1343981..1345015 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
M5T36_RS06575 (1345228) | 1345228..1345941 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
M5T36_RS06580 (1346096) | 1346096..1346323 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M5T36_RS06585 (1346323) | 1346323..1346721 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T36_RS06590 (1346868) | 1346868..1347731 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
M5T36_RS06595 (1347746) | 1347746..1349761 | + | 2016 | WP_000829295.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
M5T36_RS06600 (1349835) | 1349835..1350533 | + | 699 | WP_000679823.1 | esterase | - |
M5T36_RS06605 (1350643) | 1350643..1350843 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T255875 WP_000911329.1 NZ_CP103623:1346323-1346721 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |