Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53668..54404 Replicon plasmid pMB6483_1
Accession NZ_CP103622
Organism Klebsiella pneumoniae strain 433

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M5S60_RS25585 Protein ID WP_003026803.1
Coordinates 53922..54404 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M5S60_RS25580 Protein ID WP_003026799.1
Coordinates 53668..53934 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S60_RS25535 (M5S60_25535) 49730..50092 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M5S60_RS25540 (M5S60_25540) 50142..50492 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M5S60_RS25545 (M5S60_25545) 50850..51119 + 270 WP_004152102.1 hypothetical protein -
M5S60_RS25550 (M5S60_25550) 51107..51682 + 576 WP_004152103.1 hypothetical protein -
M5S60_RS25555 (M5S60_25555) 51713..52207 + 495 WP_004152104.1 DNA-binding protein -
M5S60_RS25560 (M5S60_25560) 52251..52619 + 369 WP_004152105.1 hypothetical protein -
M5S60_RS25565 (M5S60_25565) 52653..52856 + 204 WP_004152106.1 HHA domain-containing protein -
M5S60_RS25570 (M5S60_25570) 52905..53162 + 258 WP_004152107.1 hypothetical protein -
M5S60_RS25575 (M5S60_25575) 53238..53492 + 255 WP_004152108.1 hypothetical protein -
M5S60_RS25580 (M5S60_25580) 53668..53934 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M5S60_RS25585 (M5S60_25585) 53922..54404 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M5S60_RS25590 (M5S60_25590) 54563..55728 - 1166 Protein_57 IS3 family transposase -
M5S60_RS25595 (M5S60_25595) 55905..56867 - 963 WP_004152113.1 zinc metalloprotease HtpX -
M5S60_RS25600 (M5S60_25600) 56854..57342 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
M5S60_RS25605 (M5S60_25605) 57457..57603 - 147 Protein_60 diguanylate cyclase -
M5S60_RS25610 (M5S60_25610) 57841..58038 - 198 WP_004152115.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-15 / dfrA14 - 1..243762 243762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T255870 WP_003026803.1 NZ_CP103622:53922-54404 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT255870 WP_003026799.1 NZ_CP103622:53668-53934 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References