Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4661711..4662227 | Replicon | chromosome |
Accession | NZ_CP103621 | ||
Organism | Klebsiella pneumoniae strain 433 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M5S60_RS22660 | Protein ID | WP_040216106.1 |
Coordinates | 4661711..4661995 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5S60_RS22665 | Protein ID | WP_046654738.1 |
Coordinates | 4661985..4662227 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S60_RS22635 (4657106) | 4657106..4657369 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M5S60_RS22640 (4657499) | 4657499..4657672 | + | 174 | WP_004872639.1 | hypothetical protein | - |
M5S60_RS22645 (4657675) | 4657675..4658418 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5S60_RS22650 (4658775) | 4658775..4660913 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5S60_RS22655 (4661243) | 4661243..4661707 | + | 465 | WP_032418146.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5S60_RS22660 (4661711) | 4661711..4661995 | - | 285 | WP_040216106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S60_RS22665 (4661985) | 4661985..4662227 | - | 243 | WP_046654738.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5S60_RS22670 (4662305) | 4662305..4664215 | - | 1911 | WP_023325426.1 | PRD domain-containing protein | - |
M5S60_RS22675 (4664238) | 4664238..4665392 | - | 1155 | WP_040216103.1 | lactonase family protein | - |
M5S60_RS22680 (4665459) | 4665459..4666199 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11097.94 Da Isoelectric Point: 10.4962
>T255868 WP_040216106.1 NZ_CP103621:c4661995-4661711 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|