Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3957811..3958430 Replicon chromosome
Accession NZ_CP103621
Organism Klebsiella pneumoniae strain 433

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5S60_RS19335 Protein ID WP_002892050.1
Coordinates 3958212..3958430 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5S60_RS19330 Protein ID WP_002892066.1
Coordinates 3957811..3958185 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S60_RS19320 (3952963) 3952963..3954156 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5S60_RS19325 (3954179) 3954179..3957325 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5S60_RS19330 (3957811) 3957811..3958185 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5S60_RS19335 (3958212) 3958212..3958430 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5S60_RS19340 (3958589) 3958589..3959155 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5S60_RS19345 (3959127) 3959127..3959267 - 141 Protein_3794 hypothetical protein -
M5S60_RS19350 (3959288) 3959288..3959758 + 471 WP_002892026.1 YlaC family protein -
M5S60_RS19355 (3959733) 3959733..3961184 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5S60_RS19360 (3961285) 3961285..3961983 + 699 WP_002892021.1 GNAT family protein -
M5S60_RS19365 (3961980) 3961980..3962120 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5S60_RS19370 (3962120) 3962120..3962383 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255866 WP_002892050.1 NZ_CP103621:3958212-3958430 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255866 WP_002892066.1 NZ_CP103621:3957811-3958185 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References