Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 806534..807191 | Replicon | chromosome |
| Accession | NZ_CP103621 | ||
| Organism | Klebsiella pneumoniae strain 433 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M5S60_RS04040 | Protein ID | WP_040245400.1 |
| Coordinates | 806781..807191 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M5S60_RS04035 | Protein ID | WP_002916312.1 |
| Coordinates | 806534..806800 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S60_RS04010 (801690) | 801690..803123 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| M5S60_RS04015 (803242) | 803242..803970 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| M5S60_RS04020 (804020) | 804020..804331 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5S60_RS04025 (804495) | 804495..805154 | + | 660 | WP_048334397.1 | hemolysin III family protein | - |
| M5S60_RS04030 (805305) | 805305..806288 | - | 984 | WP_032430613.1 | tRNA-modifying protein YgfZ | - |
| M5S60_RS04035 (806534) | 806534..806800 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M5S60_RS04040 (806781) | 806781..807191 | + | 411 | WP_040245400.1 | protein YgfX | Toxin |
| M5S60_RS04045 (807198) | 807198..807719 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| M5S60_RS04050 (807820) | 807820..808716 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M5S60_RS04055 (808739) | 808739..809452 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5S60_RS04060 (809458) | 809458..811191 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T255859 WP_040245400.1 NZ_CP103621:806781-807191 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDSRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|