Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 197399..198042 Replicon plasmid pMB6487_1
Accession NZ_CP103619
Organism Klebsiella pneumoniae strain 4383

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M5T08_RS27250 Protein ID WP_014386165.1
Coordinates 197626..198042 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M5T08_RS27245 Protein ID WP_032408893.1
Coordinates 197399..197629 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T08_RS27220 (M5T08_27220) 192472..193455 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
M5T08_RS27225 (M5T08_27225) 193474..194622 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
M5T08_RS27230 (M5T08_27230) 194793..195950 - 1158 WP_032408895.1 acetylornithine deacetylase -
M5T08_RS27235 (M5T08_27235) 195966..196640 - 675 WP_014386166.1 DUF1028 domain-containing protein -
M5T08_RS27240 (M5T08_27240) 196645..197079 - 435 WP_000103648.1 RidA family protein -
M5T08_RS27245 (M5T08_27245) 197399..197629 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5T08_RS27250 (M5T08_27250) 197626..198042 + 417 WP_014386165.1 PIN domain-containing protein Toxin
M5T08_RS27255 (M5T08_27255) 198365..199333 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
M5T08_RS27260 (M5T08_27260) 199513..199887 - 375 WP_032408891.1 hypothetical protein -
M5T08_RS27265 (M5T08_27265) 199943..200269 - 327 WP_004152639.1 hypothetical protein -
M5T08_RS27270 (M5T08_27270) 200266..200994 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
M5T08_RS27275 (M5T08_27275) 200991..201422 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / sul1 / qacE / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / mph(A) - 1..218258 218258
- flank IS/Tn - - 198365..199333 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T255857 WP_014386165.1 NZ_CP103619:197626-198042 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT255857 WP_032408893.1 NZ_CP103619:197399-197629 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References