Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 173503..174248 Replicon plasmid pMB6487_1
Accession NZ_CP103619
Organism Klebsiella pneumoniae strain 4383

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag M5T08_RS27120 Protein ID WP_032408901.1
Coordinates 173757..174248 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag M5T08_RS27115 Protein ID WP_014386183.1
Coordinates 173503..173769 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T08_RS27065 (M5T08_27065) 169055..169468 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
M5T08_RS27070 (M5T08_27070) 169469..169747 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
M5T08_RS27075 (M5T08_27075) 169737..170057 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5T08_RS27080 (M5T08_27080) 170138..170362 - 225 WP_014386189.1 hypothetical protein -
M5T08_RS27085 (M5T08_27085) 170373..170585 - 213 WP_014386188.1 hypothetical protein -
M5T08_RS27090 (M5T08_27090) 170647..170973 - 327 WP_014386187.1 hypothetical protein -
M5T08_RS27095 (M5T08_27095) 171610..171960 - 351 WP_014386186.1 hypothetical protein -
M5T08_RS27100 (M5T08_27100) 171957..172229 - 273 WP_032408902.1 hypothetical protein -
M5T08_RS27105 (M5T08_27105) 172419..172904 + 486 WP_014386185.1 hypothetical protein -
M5T08_RS27110 (M5T08_27110) 173148..173306 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
M5T08_RS27115 (M5T08_27115) 173503..173769 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
M5T08_RS27120 (M5T08_27120) 173757..174248 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
M5T08_RS27125 (M5T08_27125) 174689..174940 - 252 WP_032408900.1 aldo/keto reductase -
M5T08_RS27130 (M5T08_27130) 175137..176729 - 1593 Protein_196 IS66 family transposase -
M5T08_RS27135 (M5T08_27135) 176760..177110 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
M5T08_RS27140 (M5T08_27140) 177107..177547 - 441 WP_014386179.1 transposase -
M5T08_RS27145 (M5T08_27145) 177809..178564 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / sul1 / qacE / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / mph(A) - 1..218258 218258


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T255856 WP_032408901.1 NZ_CP103619:173757-174248 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT255856 WP_014386183.1 NZ_CP103619:173503-173769 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References