Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53667..54403 | Replicon | plasmid pMB6487_1 |
Accession | NZ_CP103619 | ||
Organism | Klebsiella pneumoniae strain 4383 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | M5T08_RS26430 | Protein ID | WP_003026803.1 |
Coordinates | 53921..54403 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | M5T08_RS26425 | Protein ID | WP_003026799.1 |
Coordinates | 53667..53933 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T08_RS26380 (M5T08_26380) | 49729..50091 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
M5T08_RS26385 (M5T08_26385) | 50141..50491 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
M5T08_RS26390 (M5T08_26390) | 50849..51118 | + | 270 | WP_004152102.1 | hypothetical protein | - |
M5T08_RS26395 (M5T08_26395) | 51106..51681 | + | 576 | WP_004152103.1 | hypothetical protein | - |
M5T08_RS26400 (M5T08_26400) | 51712..52206 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
M5T08_RS26405 (M5T08_26405) | 52250..52618 | + | 369 | WP_004152105.1 | hypothetical protein | - |
M5T08_RS26410 (M5T08_26410) | 52652..52855 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
M5T08_RS26415 (M5T08_26415) | 52904..53161 | + | 258 | WP_004152107.1 | hypothetical protein | - |
M5T08_RS26420 (M5T08_26420) | 53237..53491 | + | 255 | WP_004152108.1 | hypothetical protein | - |
M5T08_RS26425 (M5T08_26425) | 53667..53933 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
M5T08_RS26430 (M5T08_26430) | 53921..54403 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
M5T08_RS26435 (M5T08_26435) | 54615..55961 | + | 1347 | WP_020314316.1 | ISNCY family transposase | - |
M5T08_RS26440 (M5T08_26440) | 56122..56253 | + | 132 | WP_004218042.1 | hypothetical protein | - |
M5T08_RS26445 (M5T08_26445) | 56462..57627 | - | 1166 | Protein_59 | IS3 family transposase | - |
M5T08_RS26450 (M5T08_26450) | 57804..58766 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
M5T08_RS26455 (M5T08_26455) | 58753..59241 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3')-Ia / sul1 / qacE / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / mph(A) | - | 1..218258 | 218258 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T255855 WP_003026803.1 NZ_CP103619:53921-54403 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |