Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4864197..4864713 | Replicon | chromosome |
| Accession | NZ_CP103618 | ||
| Organism | Klebsiella pneumoniae strain 4383 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5T08_RS23555 | Protein ID | WP_004178374.1 |
| Coordinates | 4864197..4864481 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M5T08_RS23560 | Protein ID | WP_002886901.1 |
| Coordinates | 4864471..4864713 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T08_RS23530 (4859681) | 4859681..4859944 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
| M5T08_RS23535 (4860074) | 4860074..4860247 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| M5T08_RS23540 (4860250) | 4860250..4860993 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5T08_RS23545 (4861350) | 4861350..4863488 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5T08_RS23550 (4863729) | 4863729..4864193 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5T08_RS23555 (4864197) | 4864197..4864481 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T08_RS23560 (4864471) | 4864471..4864713 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5T08_RS23565 (4864791) | 4864791..4866701 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
| M5T08_RS23570 (4866724) | 4866724..4867878 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| M5T08_RS23575 (4867945) | 4867945..4868685 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255852 WP_004178374.1 NZ_CP103618:c4864481-4864197 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |