Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4775828..4776663 Replicon chromosome
Accession NZ_CP103618
Organism Klebsiella pneumoniae strain 4383

Toxin (Protein)


Gene name yeeV Uniprot ID A0A5E2RWI0
Locus tag M5T08_RS23175 Protein ID WP_001559913.1
Coordinates 4775828..4776205 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A5E3EVB5
Locus tag M5T08_RS23180 Protein ID WP_032408847.1
Coordinates 4776295..4776663 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T08_RS23135 (4771093) 4771093..4771359 + 267 WP_004178415.1 hypothetical protein -
M5T08_RS23140 (4771359) 4771359..4772031 + 673 Protein_4536 DUF4400 domain-containing protein -
M5T08_RS23145 (4772042) 4772042..4772758 + 717 WP_223203127.1 RES domain-containing protein -
M5T08_RS23150 (4773126) 4773126..4773314 - 189 Protein_4538 transposase -
M5T08_RS23155 (4773331) 4773331..4774442 - 1112 Protein_4539 IS3 family transposase -
M5T08_RS23160 (4774892) 4774892..4775041 - 150 Protein_4540 restriction endonuclease subunit M -
M5T08_RS23165 (4775126) 4775126..4775323 - 198 WP_032408848.1 DUF957 domain-containing protein -
M5T08_RS23170 (4775343) 4775343..4775831 - 489 WP_001559914.1 DUF5983 family protein -
M5T08_RS23175 (4775828) 4775828..4776205 - 378 WP_001559913.1 TA system toxin CbtA family protein Toxin
M5T08_RS23180 (4776295) 4776295..4776663 - 369 WP_032408847.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T08_RS23185 (4776840) 4776840..4777061 - 222 WP_000692300.1 DUF987 domain-containing protein -
M5T08_RS23190 (4777130) 4777130..4777606 - 477 WP_032408846.1 RadC family protein -
M5T08_RS23195 (4777621) 4777621..4778106 - 486 WP_259387821.1 antirestriction protein -
M5T08_RS23200 (4778198) 4778198..4779016 - 819 Protein_4548 DUF945 domain-containing protein -
M5T08_RS23205 (4779116) 4779116..4779349 - 234 WP_001119729.1 DUF905 family protein -
M5T08_RS23210 (4779428) 4779428..4779883 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4764205..4794486 30281


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14148.10 Da        Isoelectric Point: 7.8276

>T255851 WP_001559913.1 NZ_CP103618:c4776205-4775828 [Klebsiella pneumoniae]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13682.62 Da        Isoelectric Point: 7.8398

>AT255851 WP_032408847.1 NZ_CP103618:c4776663-4776295 [Klebsiella pneumoniae]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVMLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E2RWI0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E3EVB5

References