Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4093310..4093929 Replicon chromosome
Accession NZ_CP103618
Organism Klebsiella pneumoniae strain 4383

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T08_RS19925 Protein ID WP_002892050.1
Coordinates 4093711..4093929 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T08_RS19920 Protein ID WP_002892066.1
Coordinates 4093310..4093684 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T08_RS19910 (4088462) 4088462..4089655 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5T08_RS19915 (4089678) 4089678..4092824 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T08_RS19920 (4093310) 4093310..4093684 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T08_RS19925 (4093711) 4093711..4093929 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T08_RS19930 (4094088) 4094088..4094654 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5T08_RS19935 (4094626) 4094626..4094766 - 141 WP_004147370.1 hypothetical protein -
M5T08_RS19940 (4094787) 4094787..4095257 + 471 WP_002892026.1 YlaC family protein -
M5T08_RS19945 (4095232) 4095232..4096683 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M5T08_RS19950 (4096784) 4096784..4097482 + 699 WP_002892021.1 GNAT family protein -
M5T08_RS19955 (4097479) 4097479..4097619 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T08_RS19960 (4097619) 4097619..4097882 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255849 WP_002892050.1 NZ_CP103618:4093711-4093929 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255849 WP_002892066.1 NZ_CP103618:4093310-4093684 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References