Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 692590..693269 | Replicon | chromosome |
Accession | NZ_CP103618 | ||
Organism | Klebsiella pneumoniae strain 4383 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
Locus tag | M5T08_RS03400 | Protein ID | WP_020324801.1 |
Coordinates | 692928..693269 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
Locus tag | M5T08_RS03395 | Protein ID | WP_020324792.1 |
Coordinates | 692590..692907 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T08_RS03370 (687805) | 687805..690957 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
M5T08_RS03375 (691050) | 691050..691289 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
M5T08_RS03380 (691392) | 691392..691849 | + | 458 | Protein_664 | antirestriction protein | - |
M5T08_RS03385 (691865) | 691865..692341 | + | 477 | WP_020324797.1 | RadC family protein | - |
M5T08_RS03390 (692350) | 692350..692577 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
M5T08_RS03395 (692590) | 692590..692907 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T08_RS03400 (692928) | 692928..693269 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
M5T08_RS03405 (693385) | 693385..694218 | + | 834 | WP_259387827.1 | DUF4942 domain-containing protein | - |
M5T08_RS03415 (694521) | 694521..695027 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
M5T08_RS03420 (695127) | 695127..696968 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T255841 WP_020324801.1 NZ_CP103618:692928-693269 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7K7A4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KEL2 |