Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 11119..11762 | Replicon | plasmid pMB6975_1 |
Accession | NZ_CP103615 | ||
Organism | Klebsiella pneumoniae strain 3571 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | M5T29_RS26040 | Protein ID | WP_016236302.1 |
Coordinates | 11346..11762 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | M5T29_RS26035 | Protein ID | WP_001261282.1 |
Coordinates | 11119..11349 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T29_RS26010 (M5T29_26010) | 6835..7092 | - | 258 | WP_023292103.1 | hypothetical protein | - |
M5T29_RS26015 (M5T29_26015) | 7570..8298 | + | 729 | Protein_6 | CSS-motif domain-containing protein | - |
M5T29_RS26020 (M5T29_26020) | 8314..9150 | + | 837 | WP_032439674.1 | EAL domain-containing protein | - |
M5T29_RS26025 (M5T29_26025) | 9768..10199 | - | 432 | WP_174805835.1 | hypothetical protein | - |
M5T29_RS26030 (M5T29_26030) | 10740..11162 | - | 423 | WP_046624301.1 | hypothetical protein | - |
M5T29_RS26035 (M5T29_26035) | 11119..11349 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5T29_RS26040 (M5T29_26040) | 11346..11762 | + | 417 | WP_016236302.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T29_RS26045 (M5T29_26045) | 11836..13398 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
M5T29_RS26050 (M5T29_26050) | 13383..14405 | + | 1023 | WP_032439672.1 | helicase UvrD | - |
M5T29_RS26055 (M5T29_26055) | 14950..15858 | + | 909 | WP_032439686.1 | HNH endonuclease | - |
M5T29_RS26060 (M5T29_26060) | 16044..16394 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / aac(3)-IIa / qnrB1 / tet(A) / aac(6')-Ib-cr / blaOXA-1 | - | 1..170849 | 170849 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15091.55 Da Isoelectric Point: 7.1084
>T255839 WP_016236302.1 NZ_CP103615:11346-11762 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLELAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|