Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5274971..5275596 | Replicon | chromosome |
| Accession | NZ_CP103614 | ||
| Organism | Klebsiella pneumoniae strain 3571 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | M5T29_RS25620 | Protein ID | WP_019705794.1 |
| Coordinates | 5274971..5275354 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M5T29_RS25625 | Protein ID | WP_004150355.1 |
| Coordinates | 5275354..5275596 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T29_RS25605 (M5T29_25605) | 5272337..5273239 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M5T29_RS25610 (M5T29_25610) | 5273236..5273871 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5T29_RS25615 (M5T29_25615) | 5273868..5274797 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| M5T29_RS25620 (M5T29_25620) | 5274971..5275354 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T29_RS25625 (M5T29_25625) | 5275354..5275596 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M5T29_RS25630 (M5T29_25630) | 5275801..5276718 | + | 918 | WP_012737090.1 | alpha/beta hydrolase | - |
| M5T29_RS25635 (M5T29_25635) | 5276732..5277673 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| M5T29_RS25640 (M5T29_25640) | 5277718..5278155 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M5T29_RS25645 (M5T29_25645) | 5278152..5279012 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M5T29_RS25650 (M5T29_25650) | 5279006..5279605 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T255838 WP_019705794.1 NZ_CP103614:c5275354-5274971 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |