Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4766506..4767022 | Replicon | chromosome |
Accession | NZ_CP103614 | ||
Organism | Klebsiella pneumoniae strain 3571 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M5T29_RS23170 | Protein ID | WP_004178374.1 |
Coordinates | 4766506..4766790 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M5T29_RS23175 | Protein ID | WP_002886901.1 |
Coordinates | 4766780..4767022 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T29_RS23145 (M5T29_23145) | 4761923..4762186 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M5T29_RS23150 (M5T29_23150) | 4762316..4762489 | + | 174 | WP_019725541.1 | hypothetical protein | - |
M5T29_RS23155 (M5T29_23155) | 4762492..4763235 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M5T29_RS23160 (M5T29_23160) | 4763592..4765730 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5T29_RS23165 (M5T29_23165) | 4766038..4766502 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5T29_RS23170 (M5T29_23170) | 4766506..4766790 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T29_RS23175 (M5T29_23175) | 4766780..4767022 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5T29_RS23180 (M5T29_23180) | 4767100..4769010 | - | 1911 | WP_048299762.1 | PRD domain-containing protein | - |
M5T29_RS23185 (M5T29_23185) | 4769033..4770187 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
M5T29_RS23190 (M5T29_23190) | 4770254..4770994 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255836 WP_004178374.1 NZ_CP103614:c4766790-4766506 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |