Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4038502..4039121 | Replicon | chromosome |
| Accession | NZ_CP103614 | ||
| Organism | Klebsiella pneumoniae strain 3571 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M5T29_RS19730 | Protein ID | WP_002892050.1 |
| Coordinates | 4038903..4039121 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M5T29_RS19725 | Protein ID | WP_002892066.1 |
| Coordinates | 4038502..4038876 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T29_RS19715 (M5T29_19715) | 4033654..4034847 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5T29_RS19720 (M5T29_19720) | 4034870..4038016 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M5T29_RS19725 (M5T29_19725) | 4038502..4038876 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T29_RS19730 (M5T29_19730) | 4038903..4039121 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M5T29_RS19735 (M5T29_19735) | 4039280..4039846 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M5T29_RS19740 (M5T29_19740) | 4039818..4039958 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M5T29_RS19745 (M5T29_19745) | 4039979..4040449 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M5T29_RS19750 (M5T29_19750) | 4040424..4041875 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| M5T29_RS19755 (M5T29_19755) | 4041976..4042674 | + | 699 | WP_032414604.1 | GNAT family protein | - |
| M5T29_RS19760 (M5T29_19760) | 4042671..4042811 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M5T29_RS19765 (M5T29_19765) | 4042811..4043074 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255834 WP_002892050.1 NZ_CP103614:4038903-4039121 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT255834 WP_002892066.1 NZ_CP103614:4038502-4038876 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |