Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 205550..206289 | Replicon | chromosome |
| Accession | NZ_CP103614 | ||
| Organism | Klebsiella pneumoniae strain 3571 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M5T29_RS01015 | Protein ID | WP_021312536.1 |
| Coordinates | 205804..206289 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | M5T29_RS01010 | Protein ID | WP_003026799.1 |
| Coordinates | 205550..205816 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T29_RS00995 (M5T29_00995) | 201054..203123 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
| M5T29_RS01000 (M5T29_01000) | 203419..204788 | + | 1370 | WP_087661561.1 | IS3 family transposase | - |
| M5T29_RS01005 (M5T29_01005) | 204989..205417 | + | 429 | WP_004901287.1 | GFA family protein | - |
| M5T29_RS01010 (M5T29_01010) | 205550..205816 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| M5T29_RS01015 (M5T29_01015) | 205804..206289 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
| M5T29_RS01020 (M5T29_01020) | 206633..206785 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
| M5T29_RS01025 (M5T29_01025) | 207087..208706 | + | 1620 | WP_032432333.1 | ATP-binding cassette domain-containing protein | - |
| M5T29_RS01030 (M5T29_01030) | 208805..209017 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| M5T29_RS01035 (M5T29_01035) | 209270..209560 | - | 291 | WP_002921931.1 | HTH-type transcriptional regulator | - |
| M5T29_RS01040 (M5T29_01040) | 209806..211161 | - | 1356 | WP_004901270.1 | aromatic acid/H+ symport family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 204063..204788 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T255825 WP_021312536.1 NZ_CP103614:205804-206289 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|