Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 97550..98289 | Replicon | plasmid pMB6956_1 |
| Accession | NZ_CP103612 | ||
| Organism | Enterobacter cloacae strain 3143 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M5S62_RS24100 | Protein ID | WP_200928210.1 |
| Coordinates | 97804..98289 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | M5S62_RS24095 | Protein ID | WP_127851259.1 |
| Coordinates | 97550..97816 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S62_RS24075 (93465) | 93465..93707 | + | 243 | WP_251885365.1 | hypothetical protein | - |
| M5S62_RS24080 (94046) | 94046..94813 | + | 768 | WP_251885366.1 | TraX family protein | - |
| M5S62_RS24085 (94835) | 94835..95131 | - | 297 | WP_251885367.1 | DUF2767 family protein | - |
| M5S62_RS24090 (95914) | 95914..96927 | - | 1014 | WP_160890736.1 | plasmid replication initiator RepA | - |
| M5S62_RS24095 (97550) | 97550..97816 | + | 267 | WP_127851259.1 | DUF1778 domain-containing protein | Antitoxin |
| M5S62_RS24100 (97804) | 97804..98289 | + | 486 | WP_200928210.1 | GNAT family N-acetyltransferase | Toxin |
| M5S62_RS24105 (98497) | 98497..98790 | + | 294 | Protein_107 | helix-turn-helix domain-containing protein | - |
| M5S62_RS24110 (98911) | 98911..99678 | - | 768 | WP_251885368.1 | DUF1883 domain-containing protein | - |
| M5S62_RS24115 (99845) | 99845..100459 | + | 615 | WP_251885369.1 | TIR domain-containing protein | - |
| M5S62_RS24120 (100499) | 100499..101206 | - | 708 | WP_251885370.1 | major royal jelly family protein | - |
| M5S62_RS24125 (101233) | 101233..101439 | - | 207 | Protein_111 | helix-turn-helix domain-containing protein | - |
| M5S62_RS24130 (101821) | 101821..102810 | + | 990 | WP_251885371.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..159348 | 159348 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17762.61 Da Isoelectric Point: 10.4605
>T255824 WP_200928210.1 NZ_CP103612:97804-98289 [Enterobacter cloacae]
VGRVKAPEPLSSFHQLVEFVSGEVVLDDWLKQRGLKNQALGAARTFVVCKKNTKQVAGFYSLATGSVNHAEATGSLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEARSFYVHHGFKLSQTQNRTLFLKLP
Q
VGRVKAPEPLSSFHQLVEFVSGEVVLDDWLKQRGLKNQALGAARTFVVCKKNTKQVAGFYSLATGSVNHAEATGSLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEARSFYVHHGFKLSQTQNRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|