Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 48127..48491 Replicon plasmid pMB6956_1
Accession NZ_CP103612
Organism Enterobacter cloacae strain 3143

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M5S62_RS23830 Protein ID WP_181403637.1
Coordinates 48354..48491 (+) Length 46 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M5S62_RS23825 Protein ID WP_032736774.1
Coordinates 48127..48357 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S62_RS23795 (43333) 43333..44262 + 930 WP_058799616.1 copper resistance inner membrane protein PcoD -
M5S62_RS23800 (44317) 44317..44997 + 681 WP_001188930.1 copper response regulator transcription factor PcoR -
M5S62_RS23805 (44994) 44994..46394 + 1401 WP_259387784.1 copper resistance membrane spanning protein PcoS -
M5S62_RS23810 (46611) 46611..47045 + 435 WP_259387785.1 copper resistance system metallochaperone PcoE -
M5S62_RS23815 (47265) 47265..47561 - 297 WP_251885415.1 type II toxin-antitoxin system RelE/ParE family toxin -
M5S62_RS23820 (47548) 47548..47808 - 261 WP_251885416.1 type II toxin-antitoxin system ParD family antitoxin -
M5S62_RS23825 (48127) 48127..48357 + 231 WP_032736774.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5S62_RS23830 (48354) 48354..48491 + 138 WP_181403637.1 hypothetical protein Toxin
M5S62_RS23835 (49271) 49271..50470 + 1200 WP_032736773.1 cation:proton antiporter -
M5S62_RS23840 (50522) 50522..50941 + 420 WP_050484447.1 universal stress protein -
M5S62_RS23845 (51180) 51180..52718 + 1539 WP_032736772.1 DNA mismatch repair protein MutS -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..159348 159348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 46 a.a.        Molecular weight: 5309.20 Da        Isoelectric Point: 4.8003

>T255823 WP_181403637.1 NZ_CP103612:48354-48491 [Enterobacter cloacae]
VNKIYMLDTNICSFIMREQPEAVLVTNNVREFERVPGLVLENWVK

Download         Length: 138 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8780.89 Da        Isoelectric Point: 4.3030

>AT255823 WP_032736774.1 NZ_CP103612:48127-48357 [Enterobacter cloacae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKAEPDFMAEREDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References