Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4001281..4001941 | Replicon | chromosome |
Accession | NZ_CP103611 | ||
Organism | Enterobacter cloacae strain 3143 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M5S62_RS19035 | Protein ID | WP_129327560.1 |
Coordinates | 4001281..4001694 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A5E1AG01 |
Locus tag | M5S62_RS19040 | Protein ID | WP_013098615.1 |
Coordinates | 4001675..4001941 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S62_RS19015 (M5S62_19015) | 3997274..3999007 | - | 1734 | WP_129327562.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5S62_RS19020 (M5S62_19020) | 3999013..3999726 | - | 714 | WP_129327561.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5S62_RS19025 (M5S62_19025) | 3999755..4000651 | - | 897 | WP_013098612.1 | site-specific tyrosine recombinase XerD | - |
M5S62_RS19030 (M5S62_19030) | 4000753..4001274 | + | 522 | WP_013098613.1 | flavodoxin FldB | - |
M5S62_RS19035 (M5S62_19035) | 4001281..4001694 | - | 414 | WP_129327560.1 | protein YgfX | Toxin |
M5S62_RS19040 (M5S62_19040) | 4001675..4001941 | - | 267 | WP_013098615.1 | FAD assembly factor SdhE | Antitoxin |
M5S62_RS19045 (M5S62_19045) | 4002236..4003216 | + | 981 | WP_023620448.1 | tRNA-modifying protein YgfZ | - |
M5S62_RS19050 (M5S62_19050) | 4003326..4003985 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
M5S62_RS19055 (M5S62_19055) | 4004251..4004982 | + | 732 | WP_259387762.1 | MurR/RpiR family transcriptional regulator | - |
M5S62_RS19060 (M5S62_19060) | 4005098..4006531 | + | 1434 | WP_020687084.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16236.21 Da Isoelectric Point: 10.9554
>T255821 WP_129327560.1 NZ_CP103611:c4001694-4001281 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDISEWRELRRMLLQQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDISEWRELRRMLLQQQPTQE
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|