Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 592475..593051 | Replicon | chromosome |
Accession | NZ_CP103611 | ||
Organism | Enterobacter cloacae strain 3143 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A5E1APA0 |
Locus tag | M5S62_RS02845 | Protein ID | WP_023620650.1 |
Coordinates | 592475..592762 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | M5S62_RS02850 | Protein ID | WP_057072722.1 |
Coordinates | 592749..593051 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S62_RS02820 (M5S62_02820) | 587538..588233 | + | 696 | WP_045295461.1 | winged helix-turn-helix domain-containing protein | - |
M5S62_RS02825 (M5S62_02825) | 588437..588907 | + | 471 | WP_013095432.1 | MarR family transcriptional regulator | - |
M5S62_RS02830 (M5S62_02830) | 588904..589971 | + | 1068 | WP_029882194.1 | HlyD family secretion protein | - |
M5S62_RS02835 (M5S62_02835) | 589961..591037 | + | 1077 | WP_013095434.1 | DUF2955 domain-containing protein | - |
M5S62_RS02840 (M5S62_02840) | 591007..592305 | - | 1299 | WP_013095435.1 | DUF445 domain-containing protein | - |
M5S62_RS02845 (M5S62_02845) | 592475..592762 | + | 288 | WP_023620650.1 | BrnT family toxin | Toxin |
M5S62_RS02850 (M5S62_02850) | 592749..593051 | + | 303 | WP_057072722.1 | BrnA antitoxin family protein | Antitoxin |
M5S62_RS02855 (M5S62_02855) | 593082..593720 | - | 639 | WP_129327048.1 | LysE family translocator | - |
M5S62_RS02860 (M5S62_02860) | 593769..594512 | - | 744 | WP_057071674.1 | AraC family transcriptional regulator | - |
M5S62_RS02865 (M5S62_02865) | 594650..596020 | + | 1371 | WP_038418628.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
M5S62_RS02870 (M5S62_02870) | 596062..596382 | - | 321 | WP_013095439.1 | hypothetical protein | - |
M5S62_RS02875 (M5S62_02875) | 596382..596927 | - | 546 | WP_013095440.1 | YfaZ family outer membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11246.60 Da Isoelectric Point: 6.8813
>T255814 WP_023620650.1 NZ_CP103611:592475-592762 [Enterobacter cloacae]
MPTEYEWDSDKAKSNQQKHGIRFEDAVLVFDDPYHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGGEIIRIIS
ARKADRKERNRYEHR
MPTEYEWDSDKAKSNQQKHGIRFEDAVLVFDDPYHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGGEIIRIIS
ARKADRKERNRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|