Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 508701..509217 | Replicon | chromosome |
| Accession | NZ_CP103611 | ||
| Organism | Enterobacter cloacae strain 3143 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M5S62_RS02435 | Protein ID | WP_058684032.1 |
| Coordinates | 508933..509217 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V3EXX3 |
| Locus tag | M5S62_RS02430 | Protein ID | WP_008501400.1 |
| Coordinates | 508701..508943 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S62_RS02415 (M5S62_02415) | 504723..505463 | + | 741 | WP_040020456.1 | KDGP aldolase family protein | - |
| M5S62_RS02420 (M5S62_02420) | 505557..506693 | + | 1137 | WP_129327021.1 | lactonase family protein | - |
| M5S62_RS02425 (M5S62_02425) | 506713..508623 | + | 1911 | WP_259387529.1 | BglG family transcription antiterminator | - |
| M5S62_RS02430 (M5S62_02430) | 508701..508943 | + | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5S62_RS02435 (M5S62_02435) | 508933..509217 | + | 285 | WP_058684032.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S62_RS02440 (M5S62_02440) | 509221..509685 | - | 465 | WP_040020449.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5S62_RS02445 (M5S62_02445) | 509822..511960 | - | 2139 | WP_013095357.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5S62_RS02450 (M5S62_02450) | 512334..513977 | - | 1644 | WP_058684031.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10930.81 Da Isoelectric Point: 10.4251
>T255813 WP_058684032.1 NZ_CP103611:508933-509217 [Enterobacter cloacae]
MTYELEFDPRALKEWSKLGETVKKQFKKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKSAVYHDANKRL
MTYELEFDPRALKEWSKLGETVKKQFKKKLAGVLVNPRIESARLHNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|