Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 285887..286483 | Replicon | chromosome |
Accession | NZ_CP103611 | ||
Organism | Enterobacter cloacae strain 3143 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | M5S62_RS01345 | Protein ID | WP_058684023.1 |
Coordinates | 286181..286483 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M5S62_RS01340 | Protein ID | WP_057072139.1 |
Coordinates | 285887..286174 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S62_RS01335 (M5S62_01335) | 284259..285890 | + | 1632 | WP_013095027.1 | Na/Pi cotransporter family protein | - |
M5S62_RS01340 (M5S62_01340) | 285887..286174 | - | 288 | WP_057072139.1 | putative addiction module antidote protein | Antitoxin |
M5S62_RS01345 (M5S62_01345) | 286181..286483 | - | 303 | WP_058684023.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S62_RS01350 (M5S62_01350) | 286681..287550 | + | 870 | WP_023621411.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
M5S62_RS01355 (M5S62_01355) | 287618..288562 | - | 945 | WP_013095031.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
M5S62_RS01360 (M5S62_01360) | 288655..290004 | - | 1350 | WP_013095032.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11517.34 Da Isoelectric Point: 9.9670
>T255812 WP_058684023.1 NZ_CP103611:c286483-286181 [Enterobacter cloacae]
MKEIVQTESFRRWEQNLKDRRARTIIASRLFRLANGLAGDIKPVGEGICELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRARTIIASRLFRLANGLAGDIKPVGEGICELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|