Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 178943..179547 | Replicon | chromosome |
Accession | NZ_CP103611 | ||
Organism | Enterobacter cloacae strain 3143 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A421IJD5 |
Locus tag | M5S62_RS00870 | Protein ID | WP_071843252.1 |
Coordinates | 178943..179128 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A7Z1F6W0 |
Locus tag | M5S62_RS00875 | Protein ID | WP_013094943.1 |
Coordinates | 179143..179547 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S62_RS00855 (M5S62_00855) | 175374..176912 | + | 1539 | WP_020686520.1 | aldehyde dehydrogenase family protein | - |
M5S62_RS00860 (M5S62_00860) | 176909..177874 | - | 966 | WP_061771396.1 | LysR family transcriptional regulator | - |
M5S62_RS00865 (M5S62_00865) | 177992..178732 | + | 741 | WP_013094942.1 | MipA/OmpV family protein | - |
M5S62_RS00870 (M5S62_00870) | 178943..179128 | + | 186 | WP_071843252.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M5S62_RS00875 (M5S62_00875) | 179143..179547 | + | 405 | WP_013094943.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M5S62_RS00880 (M5S62_00880) | 179601..181556 | - | 1956 | WP_259387515.1 | glycoside hydrolase family 127 protein | - |
M5S62_RS00885 (M5S62_00885) | 181567..182967 | - | 1401 | WP_129327141.1 | MFS transporter | - |
M5S62_RS00890 (M5S62_00890) | 183192..184010 | + | 819 | WP_020686525.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6859.08 Da Isoelectric Point: 11.7891
>T255811 WP_071843252.1 NZ_CP103611:178943-179128 [Enterobacter cloacae]
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14915.74 Da Isoelectric Point: 4.3036
>AT255811 WP_013094943.1 NZ_CP103611:179143-179547 [Enterobacter cloacae]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A421IJD5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z1F6W0 |