Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 83465..84066 | Replicon | plasmid pMB7206_1 |
| Accession | NZ_CP103610 | ||
| Organism | Escherichia coli strain 4314 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | M5S83_RS24020 | Protein ID | WP_001216034.1 |
| Coordinates | 83465..83845 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | M5S83_RS24025 | Protein ID | WP_001190712.1 |
| Coordinates | 83845..84066 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S83_RS23990 (M5S83_23990) | 78565..78684 | - | 120 | WP_071527722.1 | ash family protein | - |
| M5S83_RS23995 (M5S83_23995) | 78906..80390 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| M5S83_RS24000 (M5S83_24000) | 80390..81583 | - | 1194 | WP_166465177.1 | terminase | - |
| M5S83_RS24005 (M5S83_24005) | 81669..82121 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| M5S83_RS24010 (M5S83_24010) | 82210..83253 | - | 1044 | WP_001561086.1 | DUF968 domain-containing protein | - |
| M5S83_RS24015 (M5S83_24015) | 83281..83460 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| M5S83_RS24020 (M5S83_24020) | 83465..83845 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5S83_RS24025 (M5S83_24025) | 83845..84066 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5S83_RS24030 (M5S83_24030) | 84249..85805 | + | 1557 | WP_166465176.1 | type I restriction-modification system subunit M | - |
| M5S83_RS24035 (M5S83_24035) | 85802..87004 | + | 1203 | WP_166465175.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..98694 | 98694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T255810 WP_001216034.1 NZ_CP103610:c83845-83465 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |