Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4051223..4051877 | Replicon | chromosome |
Accession | NZ_CP103609 | ||
Organism | Escherichia coli strain 4314 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | M5S83_RS19490 | Protein ID | WP_000244772.1 |
Coordinates | 4051223..4051630 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M5S83_RS19495 | Protein ID | WP_000354046.1 |
Coordinates | 4051611..4051877 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S83_RS19470 (4047180) | 4047180..4048913 | - | 1734 | WP_023155905.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5S83_RS19475 (4048919) | 4048919..4049629 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5S83_RS19480 (4049654) | 4049654..4050550 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M5S83_RS19485 (4050662) | 4050662..4051183 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
M5S83_RS19490 (4051223) | 4051223..4051630 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
M5S83_RS19495 (4051611) | 4051611..4051877 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M5S83_RS19500 (4052120) | 4052120..4053100 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
M5S83_RS19505 (4053177) | 4053177..4053836 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
M5S83_RS19510 (4054000) | 4054000..4054311 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
M5S83_RS19515 (4054356) | 4054356..4055789 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
M5S83_RS19520 (4055846) | 4055846..4056589 | - | 744 | WP_023155906.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T255807 WP_000244772.1 NZ_CP103609:c4051630-4051223 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |