Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 31024..31825 | Replicon | chromosome |
Accession | NZ_CP103609 | ||
Organism | Escherichia coli strain 4314 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
Locus tag | M5S83_RS00200 | Protein ID | WP_001094437.1 |
Coordinates | 31448..31825 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
Locus tag | M5S83_RS00195 | Protein ID | WP_001390338.1 |
Coordinates | 31024..31401 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S83_RS00170 (28142) | 28142..28337 | + | 196 | Protein_33 | DUF905 family protein | - |
M5S83_RS00175 (28455) | 28455..29273 | + | 819 | WP_001234716.1 | DUF932 domain-containing protein | - |
M5S83_RS00180 (29612) | 29612..30085 | + | 474 | WP_001387789.1 | antirestriction protein | - |
M5S83_RS00185 (30101) | 30101..30577 | + | 477 | WP_001186773.1 | RadC family protein | - |
M5S83_RS00190 (30640) | 30640..30861 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
M5S83_RS00195 (31024) | 31024..31401 | + | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5S83_RS00200 (31448) | 31448..31825 | + | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
M5S83_RS00205 (31822) | 31822..32310 | + | 489 | WP_000761716.1 | DUF5983 family protein | - |
M5S83_RS00210 (32330) | 32330..32527 | + | 198 | WP_000772032.1 | DUF957 domain-containing protein | - |
M5S83_RS00215 (32612) | 32612..33457 | + | 846 | WP_001274561.1 | DUF4942 domain-containing protein | - |
M5S83_RS00220 (33692) | 33692..33820 | + | 129 | Protein_43 | virulence RhuM family protein | - |
M5S83_RS00225 (34250) | 34250..35433 | + | 1184 | Protein_44 | sugar efflux transporter | - |
M5S83_RS00230 (35544) | 35544..36467 | + | 924 | WP_000535959.1 | carboxylate/amino acid/amine transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T255790 WP_001094437.1 NZ_CP103609:31448-31825 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT255790 WP_001390338.1 NZ_CP103609:31024-31401 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XS49 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTQ1 |