Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17490..18127 Replicon plasmid pMB7231_2
Accession NZ_CP103607
Organism Klebsiella pneumoniae strain 4386

Toxin (Protein)


Gene name vagD Uniprot ID A0A9E6WXZ4
Locus tag M5S85_RS26050 Protein ID WP_032662169.1
Coordinates 17717..18127 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A9E6WTF5
Locus tag M5S85_RS26045 Protein ID WP_032662167.1
Coordinates 17490..17720 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S85_RS26010 (M5S85_26010) 12647..13120 + 474 WP_004152341.1 YkgJ family cysteine cluster protein -
M5S85_RS26015 (M5S85_26015) 13212..13442 + 231 WP_011977773.1 hypothetical protein -
M5S85_RS26020 (M5S85_26020) 14334..15116 - 783 WP_004152340.1 site-specific integrase -
M5S85_RS26025 (M5S85_26025) 15116..15448 - 333 WP_004152339.1 hypothetical protein -
M5S85_RS26030 (M5S85_26030) 15455..15853 - 399 WP_004171440.1 hypothetical protein -
M5S85_RS26035 (M5S85_26035) 15879..16208 - 330 WP_004152337.1 hypothetical protein -
M5S85_RS26040 (M5S85_26040) 16236..16544 - 309 WP_004152336.1 hypothetical protein -
M5S85_RS26045 (M5S85_26045) 17490..17720 + 231 WP_032662167.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5S85_RS26050 (M5S85_26050) 17717..18127 + 411 WP_032662169.1 PIN domain-containing protein Toxin
M5S85_RS26055 (M5S85_26055) 18201..18890 + 690 Protein_18 ATP-binding protein -
M5S85_RS26060 (M5S85_26060) 18945..19642 + 698 WP_223174630.1 IS1 family transposase -
M5S85_RS26065 (M5S85_26065) 19658..19768 + 111 Protein_20 mercuric transport protein periplasmic component -
M5S85_RS26070 (M5S85_26070) 19804..20226 + 423 WP_001340589.1 organomercurial transporter MerC -
M5S85_RS26075 (M5S85_26075) 20278..21972 + 1695 WP_000105636.1 mercury(II) reductase -
M5S85_RS26080 (M5S85_26080) 21990..22352 + 363 WP_001277456.1 mercury resistance co-regulator MerD -
M5S85_RS26085 (M5S85_26085) 22349..22585 + 237 WP_000993386.1 broad-spectrum mercury transporter MerE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1A / blaOXA-9 / blaKPC-2 - 1..114874 114874
- flank IS/Tn - - 11259..12527 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-127)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14729.03 Da        Isoelectric Point: 5.7351

>T255789 WP_032662169.1 NZ_CP103607:17717-18127 [Klebsiella pneumoniae]
VNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWAEVSLASQEAGPAAQKLADAFAARLDAILPWDRTAV
DATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8645.77 Da        Isoelectric Point: 4.4692

>AT255789 WP_032662167.1 NZ_CP103607:17490-17720 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMAERGDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References