Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5150989..5151614 | Replicon | chromosome |
Accession | NZ_CP103605 | ||
Organism | Klebsiella pneumoniae strain 4386 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378FVD4 |
Locus tag | M5S85_RS24885 | Protein ID | WP_019705794.1 |
Coordinates | 5150989..5151372 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | M5S85_RS24890 | Protein ID | WP_004150355.1 |
Coordinates | 5151372..5151614 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S85_RS24870 (5148355) | 5148355..5149257 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
M5S85_RS24875 (5149254) | 5149254..5149889 | + | 636 | WP_032430299.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S85_RS24880 (5149886) | 5149886..5150815 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
M5S85_RS24885 (5150989) | 5150989..5151372 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5S85_RS24890 (5151372) | 5151372..5151614 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
M5S85_RS24895 (5151819) | 5151819..5152736 | + | 918 | WP_032430300.1 | alpha/beta hydrolase | - |
M5S85_RS24900 (5152751) | 5152751..5153692 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
M5S85_RS24905 (5153737) | 5153737..5154174 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
M5S85_RS24910 (5154171) | 5154171..5155031 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
M5S85_RS24915 (5155025) | 5155025..5155624 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T255788 WP_019705794.1 NZ_CP103605:c5151372-5150989 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378FVD4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |