Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-dnstrm_HI1420
Location 11970..12547 Replicon plasmid pMB7536_4
Accession NZ_CP103600
Organism Escherichia coli strain 4848

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag M5T19_RS24335 Protein ID WP_097337538.1
Coordinates 11970..12272 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M5T19_RS24340 Protein ID WP_002215736.1
Coordinates 12269..12547 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T19_RS24300 (M5T19_24300) 7366..8307 - 942 WP_002215727.1 replication initiator protein A -
M5T19_RS24305 (M5T19_24305) 9261..9776 + 516 WP_243045725.1 J domain-containing protein -
M5T19_RS24310 (M5T19_24310) 9856..10398 + 543 WP_243045723.1 hypothetical protein -
M5T19_RS24315 (M5T19_24315) 10395..10640 + 246 WP_243045722.1 hypothetical protein -
M5T19_RS24320 (M5T19_24320) 10637..10852 + 216 WP_002215731.1 helix-turn-helix domain-containing protein -
M5T19_RS24325 (M5T19_24325) 11246..11458 + 213 WP_002215732.1 hypothetical protein -
M5T19_RS24330 (M5T19_24330) 11509..11652 + 144 WP_002215733.1 hypothetical protein -
M5T19_RS24335 (M5T19_24335) 11970..12272 + 303 WP_097337538.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5T19_RS24340 (M5T19_24340) 12269..12547 + 279 WP_002215736.1 putative addiction module antidote protein Antitoxin
M5T19_RS24345 (M5T19_24345) 12603..12827 + 225 WP_243045719.1 hypothetical protein -
M5T19_RS24350 (M5T19_24350) 13215..13775 + 561 WP_259384662.1 DNA distortion polypeptide 1 -
M5T19_RS24355 (M5T19_24355) 13777..14955 + 1179 WP_243045669.1 MobP1 family relaxase -
M5T19_RS24360 (M5T19_24360) 15027..15497 + 471 WP_002215741.1 hypothetical protein -
M5T19_RS24365 (M5T19_24365) 16138..16308 + 171 WP_002215744.1 hypothetical protein -
M5T19_RS24370 (M5T19_24370) 16302..16910 + 609 WP_002215745.1 lytic transglycosylase domain-containing protein -
M5T19_RS24375 (M5T19_24375) 16903..17190 + 288 WP_243045670.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..29563 29563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-96)

Antitoxin

Uncharacterized protein HI1420

(2-89)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11329.20 Da        Isoelectric Point: 10.0083

>T255774 WP_097337538.1 NZ_CP103600:11970-12272 [Escherichia coli]
MITVLSTEIFDNWIDALKDVRAKTKIQARIRRLKNGNSGDIEPVGEGFSEMRIHEGKGYRVYLKKHGKVIVVLLCGGDKS
TQQKDILRAKAIYKEIEGEL

Download         Length: 303 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10233.79 Da        Isoelectric Point: 5.6174

>AT255774 WP_002215736.1 NZ_CP103600:12269-12547 [Escherichia coli]
MKIKEYDIAEHLNSEEEMQMYLNEIMEDGEPSLVLSALGDIARARNMSQLSREVGMSREGLYHALSGKGNPTFSAMMKIT
KALGLKLHFTGA

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References