Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 5029..5551 Replicon plasmid pMB7536_3
Accession NZ_CP103599
Organism Escherichia coli strain 4848

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M5T19_RS24085 Protein ID WP_000220560.1
Coordinates 5029..5310 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M5T19_RS24090 Protein ID WP_000121743.1
Coordinates 5300..5551 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T19_RS24045 (M5T19_24045) 1108..1308 - 201 WP_046788569.1 cell surface composition regulator GlgS -
M5T19_RS24050 (M5T19_24050) 1577..1825 + 249 Protein_2 YqiJ family protein -
M5T19_RS24055 (M5T19_24055) 1890..2594 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
M5T19_RS24060 (M5T19_24060) 2656..2853 - 198 WP_000844102.1 hypothetical protein -
M5T19_RS24065 (M5T19_24065) 2858..3367 - 510 WP_000893479.1 restriction endonuclease -
M5T19_RS24070 (M5T19_24070) 3555..3866 - 312 WP_001452736.1 hypothetical protein -
M5T19_RS24075 (M5T19_24075) 3902..4216 - 315 WP_000734776.1 TrbM/KikA/MpfK family conjugal transfer protein -
M5T19_RS24085 (M5T19_24085) 5029..5310 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5T19_RS24090 (M5T19_24090) 5300..5551 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M5T19_RS24095 (M5T19_24095) 6785..7621 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
M5T19_RS24100 (M5T19_24100) 7661..8107 + 447 Protein_12 hypothetical protein -
M5T19_RS24105 (M5T19_24105) 8244..8600 + 357 WP_000456533.1 DNA distortion polypeptide 3 -
M5T19_RS24110 (M5T19_24110) 8597..9574 - 978 WP_024245156.1 hypothetical protein -
M5T19_RS24115 (M5T19_24115) 9599..9880 - 282 WP_001185482.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 - 1..34426 34426


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T255773 WP_000220560.1 NZ_CP103599:c5310-5029 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT255773 WP_000121743.1 NZ_CP103599:c5551-5300 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References