Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4145854..4146449 | Replicon | chromosome |
| Accession | NZ_CP103596 | ||
| Organism | Escherichia coli strain 4848 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | M5T19_RS20170 | Protein ID | WP_000239579.1 |
| Coordinates | 4145854..4146204 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | M5T19_RS20175 | Protein ID | WP_001223208.1 |
| Coordinates | 4146198..4146449 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T19_RS20150 (4141130) | 4141130..4142152 | - | 1023 | WP_024198507.1 | ABC transporter permease | - |
| M5T19_RS20155 (4142166) | 4142166..4143668 | - | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
| M5T19_RS20160 (4143978) | 4143978..4144934 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| M5T19_RS20165 (4145244) | 4145244..4145774 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| M5T19_RS20170 (4145854) | 4145854..4146204 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| M5T19_RS20175 (4146198) | 4146198..4146449 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| M5T19_RS20180 (4146662) | 4146662..4147003 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| M5T19_RS20185 (4147006) | 4147006..4150785 | - | 3780 | WP_000060921.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T255770 WP_000239579.1 NZ_CP103596:c4146204-4145854 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |