Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4034645..4035477 | Replicon | chromosome |
Accession | NZ_CP103596 | ||
Organism | Escherichia coli strain 4848 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A7ZVJ9 |
Locus tag | M5T19_RS19590 | Protein ID | WP_000854765.1 |
Coordinates | 4034645..4035019 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | M5T19_RS19595 | Protein ID | WP_001295723.1 |
Coordinates | 4035109..4035477 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T19_RS19570 (4030102) | 4030102..4033218 | + | 3117 | WP_000149665.1 | HsdR family type I site-specific deoxyribonuclease | - |
M5T19_RS19575 (4033709) | 4033709..4033858 | - | 150 | Protein_3825 | hypothetical protein | - |
M5T19_RS19580 (4033964) | 4033964..4034140 | - | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
M5T19_RS19585 (4034157) | 4034157..4034648 | - | 492 | WP_000976842.1 | DUF5983 family protein | - |
M5T19_RS19590 (4034645) | 4034645..4035019 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
M5T19_RS19595 (4035109) | 4035109..4035477 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T19_RS19600 (4035640) | 4035640..4035861 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
M5T19_RS19605 (4035924) | 4035924..4036400 | - | 477 | WP_001186774.1 | RadC family protein | - |
M5T19_RS19610 (4036416) | 4036416..4036889 | - | 474 | WP_000855059.1 | antirestriction protein | - |
M5T19_RS19615 (4037231) | 4037231..4038049 | - | 819 | WP_046464190.1 | DUF932 domain-containing protein | - |
M5T19_RS19620 (4038167) | 4038167..4038362 | - | 196 | Protein_3834 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T255769 WP_000854765.1 NZ_CP103596:c4035019-4034645 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255769 WP_001295723.1 NZ_CP103596:c4035477-4035109 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|