Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1320806..1321431 | Replicon | chromosome |
Accession | NZ_CP103596 | ||
Organism | Escherichia coli strain 4848 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | M5T19_RS06395 | Protein ID | WP_000911329.1 |
Coordinates | 1321033..1321431 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | M5T19_RS06390 | Protein ID | WP_000450524.1 |
Coordinates | 1320806..1321033 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T19_RS06365 (1316607) | 1316607..1317077 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
M5T19_RS06370 (1317077) | 1317077..1317649 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
M5T19_RS06375 (1317795) | 1317795..1318673 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
M5T19_RS06380 (1318690) | 1318690..1319724 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
M5T19_RS06385 (1319937) | 1319937..1320650 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
M5T19_RS06390 (1320806) | 1320806..1321033 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M5T19_RS06395 (1321033) | 1321033..1321431 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T19_RS06400 (1321578) | 1321578..1322441 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
M5T19_RS06405 (1322456) | 1322456..1324471 | + | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
M5T19_RS06410 (1324545) | 1324545..1325243 | + | 699 | WP_000679812.1 | esterase | - |
M5T19_RS06415 (1325353) | 1325353..1325553 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T255755 WP_000911329.1 NZ_CP103596:1321033-1321431 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |