Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1037141..1037724 | Replicon | chromosome |
Accession | NZ_CP103596 | ||
Organism | Escherichia coli strain 4848 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | M5T19_RS05000 | Protein ID | WP_000254738.1 |
Coordinates | 1037389..1037724 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | M5T19_RS04995 | Protein ID | WP_000581937.1 |
Coordinates | 1037141..1037389 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T19_RS04985 (1033480) | 1033480..1034781 | + | 1302 | WP_046464058.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
M5T19_RS04990 (1034829) | 1034829..1037063 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
M5T19_RS04995 (1037141) | 1037141..1037389 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M5T19_RS05000 (1037389) | 1037389..1037724 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
M5T19_RS05005 (1037795) | 1037795..1038586 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
M5T19_RS05010 (1038814) | 1038814..1040451 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
M5T19_RS05015 (1040539) | 1040539..1041837 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
M5T19_RS05020 (1041893) | 1041893..1042255 | - | 363 | WP_000034928.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T255754 WP_000254738.1 NZ_CP103596:1037389-1037724 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|