Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 862907..863561 | Replicon | chromosome |
| Accession | NZ_CP103596 | ||
| Organism | Escherichia coli strain 4848 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | M5T19_RS04225 | Protein ID | WP_000244772.1 |
| Coordinates | 863154..863561 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M5T19_RS04220 | Protein ID | WP_000354046.1 |
| Coordinates | 862907..863173 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T19_RS04195 (858195) | 858195..858938 | + | 744 | WP_000951940.1 | SDR family oxidoreductase | - |
| M5T19_RS04200 (858995) | 858995..860428 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
| M5T19_RS04205 (860473) | 860473..860784 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T19_RS04210 (860948) | 860948..861607 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| M5T19_RS04215 (861684) | 861684..862664 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| M5T19_RS04220 (862907) | 862907..863173 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M5T19_RS04225 (863154) | 863154..863561 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| M5T19_RS04230 (863601) | 863601..864122 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M5T19_RS04235 (864234) | 864234..865130 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M5T19_RS04240 (865155) | 865155..865865 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T19_RS04245 (865871) | 865871..867604 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T255753 WP_000244772.1 NZ_CP103596:863154-863561 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |