Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 129128..129729 Replicon plasmid pMB7542_1
Accession NZ_CP103593
Organism Escherichia coli O25b:H4-ST131 strain 4224

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag M5S53_RS25715 Protein ID WP_001216034.1
Coordinates 129349..129729 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5S53_RS25710 Protein ID WP_001190712.1
Coordinates 129128..129349 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S53_RS25700 (126109) 126109..127392 - 1284 WP_001617890.1 restriction endonuclease subunit S -
M5S53_RS25705 (127389) 127389..128945 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
M5S53_RS25710 (129128) 129128..129349 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5S53_RS25715 (129349) 129349..129729 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5S53_RS25720 (129734) 129734..129913 + 180 WP_001513661.1 hypothetical protein -
M5S53_RS25725 (129941) 129941..130219 + 279 Protein_156 pdcB -
M5S53_RS25730 (130224) 130224..130637 + 414 Protein_157 integrase core domain-containing protein -
M5S53_RS25735 (130587) 130587..130922 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
M5S53_RS25740 (131132) 131132..132112 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
M5S53_RS25745 (132356) 132356..133759 + 1404 WP_001373486.1 S-methylmethionine permease -
M5S53_RS25750 (133746) 133746..134678 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB 1..138020 138020


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T255751 WP_001216034.1 NZ_CP103593:129349-129729 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT255751 WP_001190712.1 NZ_CP103593:129128-129349 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References