Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 118659..119184 | Replicon | plasmid pMB7542_1 |
| Accession | NZ_CP103593 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | M5S53_RS25670 | Protein ID | WP_001159868.1 |
| Coordinates | 118659..118964 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | M5S53_RS25675 | Protein ID | WP_000813634.1 |
| Coordinates | 118966..119184 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS25650 (114500) | 114500..116008 | + | 1509 | WP_001189113.1 | group II intron reverse transcriptase/maturase | - |
| M5S53_RS25655 (116092) | 116092..116217 | + | 126 | Protein_142 | IS3 family transposase | - |
| M5S53_RS25660 (116270) | 116270..116974 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| M5S53_RS25665 (117852) | 117852..118658 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| M5S53_RS25670 (118659) | 118659..118964 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M5S53_RS25675 (118966) | 118966..119184 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M5S53_RS25680 (119892) | 119892..120887 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| M5S53_RS25685 (120930) | 120930..121823 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..138020 | 138020 | |
| - | inside | IScluster/Tn | - | - | 112757..122463 | 9706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T255750 WP_001159868.1 NZ_CP103593:c118964-118659 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|