Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4352484..4353319 | Replicon | chromosome |
| Accession | NZ_CP103592 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 4224 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | M5S53_RS21455 | Protein ID | WP_000854759.1 |
| Coordinates | 4352484..4352861 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | M5S53_RS21460 | Protein ID | WP_001295723.1 |
| Coordinates | 4352951..4353319 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S53_RS21430 (4348595) | 4348595..4350217 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| M5S53_RS21435 (4351008) | 4351008..4351184 | - | 177 | Protein_4206 | helix-turn-helix domain-containing protein | - |
| M5S53_RS21440 (4351551) | 4351551..4351700 | - | 150 | Protein_4207 | hypothetical protein | - |
| M5S53_RS21445 (4351806) | 4351806..4351982 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| M5S53_RS21450 (4351999) | 4351999..4352487 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| M5S53_RS21455 (4352484) | 4352484..4352861 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| M5S53_RS21460 (4352951) | 4352951..4353319 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S53_RS21465 (4353482) | 4353482..4353703 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S53_RS21470 (4353766) | 4353766..4354242 | - | 477 | WP_001186775.1 | RadC family protein | - |
| M5S53_RS21475 (4354258) | 4354258..4354731 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| M5S53_RS21480 (4355073) | 4355073..4355699 | - | 627 | Protein_4215 | DUF945 domain-containing protein | - |
| M5S53_RS21485 (4355887) | 4355887..4357428 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| M5S53_RS21490 (4357443) | 4357443..4358189 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4340838..4369960 | 29122 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T255739 WP_000854759.1 NZ_CP103592:c4352861-4352484 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT255739 WP_001295723.1 NZ_CP103592:c4353319-4352951 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |