Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1944398..1945229 Replicon chromosome
Accession NZ_CP103592
Organism Escherichia coli O25b:H4-ST131 strain 4224

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M5S53_RS09240 Protein ID WP_000854815.1
Coordinates 1944398..1944772 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag M5S53_RS09245 Protein ID WP_001280918.1
Coordinates 1944861..1945229 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S53_RS09200 (1939794) 1939794..1940960 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M5S53_RS09205 (1941079) 1941079..1941552 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
M5S53_RS09210 (1941750) 1941750..1942808 + 1059 WP_001200889.1 FUSC family protein -
M5S53_RS09215 (1942980) 1942980..1943309 + 330 WP_000450409.1 DUF496 family protein -
M5S53_RS09220 (1943410) 1943410..1943733 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
M5S53_RS09225 (1943712) 1943712..1943792 + 81 WP_023441679.1 hypothetical protein -
M5S53_RS09230 (1944081) 1944081..1944161 - 81 Protein_1809 hypothetical protein -
M5S53_RS09235 (1944207) 1944207..1944401 - 195 WP_000988600.1 DUF5983 family protein -
M5S53_RS09240 (1944398) 1944398..1944772 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M5S53_RS09245 (1944861) 1944861..1945229 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S53_RS09250 (1945245) 1945245..1945889 - 645 WP_000086752.1 hypothetical protein -
M5S53_RS09255 (1945908) 1945908..1946129 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5S53_RS09260 (1946192) 1946192..1946668 - 477 WP_001186200.1 RadC family protein -
M5S53_RS09265 (1946684) 1946684..1947157 - 474 WP_001542276.1 antirestriction protein -
M5S53_RS09270 (1947251) 1947251..1947496 - 246 WP_001164966.1 hypothetical protein -
M5S53_RS09275 (1947496) 1947496..1948314 - 819 WP_001542275.1 DUF932 domain-containing protein -
M5S53_RS09280 (1948535) 1948535..1948945 - 411 WP_000846703.1 hypothetical protein -
M5S53_RS09285 (1948961) 1948961..1949311 - 351 Protein_1820 hypothetical protein -
M5S53_RS09290 (1949394) 1949394..1950140 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T255728 WP_000854815.1 NZ_CP103592:c1944772-1944398 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT255728 WP_001280918.1 NZ_CP103592:c1945229-1944861 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References