Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 821826..822660 Replicon chromosome
Accession NZ_CP103592
Organism Escherichia coli O25b:H4-ST131 strain 4224

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M5S53_RS04000 Protein ID WP_000854690.1
Coordinates 821826..822203 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M5S53_RS04005 Protein ID WP_001305076.1
Coordinates 822292..822660 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S53_RS03970 (818220) 818220..818390 - 171 Protein_780 IS110 family transposase -
M5S53_RS03975 (818807) 818807..819740 - 934 Protein_781 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5S53_RS03980 (819733) 819733..820128 - 396 WP_000208384.1 DUF6088 family protein -
M5S53_RS03985 (820197) 820197..821042 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M5S53_RS03990 (821127) 821127..821324 - 198 WP_000839293.1 DUF957 domain-containing protein -
M5S53_RS03995 (821341) 821341..821829 - 489 WP_000761699.1 DUF5983 family protein -
M5S53_RS04000 (821826) 821826..822203 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M5S53_RS04005 (822292) 822292..822660 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S53_RS04010 (822710) 822710..823354 - 645 WP_000094916.1 hypothetical protein -
M5S53_RS04015 (823373) 823373..823594 - 222 WP_000692329.1 DUF987 domain-containing protein -
M5S53_RS04020 (823657) 823657..824133 - 477 WP_001186726.1 RadC family protein -
M5S53_RS04025 (824149) 824149..824634 - 486 WP_000849565.1 antirestriction protein -
M5S53_RS04030 (824689) 824689..825507 - 819 WP_001234620.1 DUF932 domain-containing protein -
M5S53_RS04035 (825608) 825608..825841 - 234 WP_000902034.1 DUF905 family protein -
M5S53_RS04040 (825920) 825920..826375 - 456 WP_000581502.1 IrmA family protein -
M5S53_RS04045 (826451) 826451..827578 - 1128 Protein_795 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 802276..868332 66056
- flank IS/Tn - - 818220..818375 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T255725 WP_000854690.1 NZ_CP103592:c822203-821826 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT255725 WP_001305076.1 NZ_CP103592:c822660-822292 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References