Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 76031..76674 | Replicon | plasmid pMB7603_2 |
| Accession | NZ_CP103591 | ||
| Organism | Escherichia coli strain 4750 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | M5T00_RS26200 | Protein ID | WP_001034046.1 |
| Coordinates | 76031..76447 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | M5T00_RS26205 | Protein ID | WP_001261278.1 |
| Coordinates | 76444..76674 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T00_RS26185 (M5T00_26185) | 71168..71584 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| M5T00_RS26190 (M5T00_26190) | 71581..71811 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M5T00_RS26195 (M5T00_26195) | 72192..75986 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| M5T00_RS26200 (M5T00_26200) | 76031..76447 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5T00_RS26205 (M5T00_26205) | 76444..76674 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5T00_RS26210 (M5T00_26210) | 76939..77439 | + | 501 | WP_001773886.1 | HEPN family nuclease | - |
| M5T00_RS26215 (M5T00_26215) | 77452..78225 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| M5T00_RS26220 (M5T00_26220) | 78392..79525 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| M5T00_RS26225 (M5T00_26225) | 79559..80071 | - | 513 | WP_000151784.1 | hypothetical protein | - |
| M5T00_RS26230 (M5T00_26230) | 80638..80856 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| M5T00_RS26235 (M5T00_26235) | 80858..81163 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | senB | 1..82743 | 82743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T255721 WP_001034046.1 NZ_CP103591:c76447-76031 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |