Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 76031..76674 Replicon plasmid pMB7603_2
Accession NZ_CP103591
Organism Escherichia coli strain 4750

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag M5T00_RS26200 Protein ID WP_001034046.1
Coordinates 76031..76447 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag M5T00_RS26205 Protein ID WP_001261278.1
Coordinates 76444..76674 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T00_RS26185 (M5T00_26185) 71168..71584 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
M5T00_RS26190 (M5T00_26190) 71581..71811 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M5T00_RS26195 (M5T00_26195) 72192..75986 + 3795 WP_001144732.1 hypothetical protein -
M5T00_RS26200 (M5T00_26200) 76031..76447 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
M5T00_RS26205 (M5T00_26205) 76444..76674 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5T00_RS26210 (M5T00_26210) 76939..77439 + 501 WP_001773886.1 HEPN family nuclease -
M5T00_RS26215 (M5T00_26215) 77452..78225 + 774 WP_000905949.1 hypothetical protein -
M5T00_RS26220 (M5T00_26220) 78392..79525 + 1134 WP_001542067.1 DUF3800 domain-containing protein -
M5T00_RS26225 (M5T00_26225) 79559..80071 - 513 WP_000151784.1 hypothetical protein -
M5T00_RS26230 (M5T00_26230) 80638..80856 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
M5T00_RS26235 (M5T00_26235) 80858..81163 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - senB 1..82743 82743


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T255721 WP_001034046.1 NZ_CP103591:c76447-76031 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT255721 WP_001261278.1 NZ_CP103591:c76674-76444 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References