Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 71168..71811 | Replicon | plasmid pMB7603_2 |
Accession | NZ_CP103591 | ||
Organism | Escherichia coli strain 4750 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | M5T00_RS26185 | Protein ID | WP_001034044.1 |
Coordinates | 71168..71584 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | M5T00_RS26190 | Protein ID | WP_001261286.1 |
Coordinates | 71581..71811 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T00_RS26170 (M5T00_26170) | 67570..68267 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
M5T00_RS26175 (M5T00_26175) | 68521..69543 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
M5T00_RS26180 (M5T00_26180) | 69528..71093 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
M5T00_RS26185 (M5T00_26185) | 71168..71584 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T00_RS26190 (M5T00_26190) | 71581..71811 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5T00_RS26195 (M5T00_26195) | 72192..75986 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
M5T00_RS26200 (M5T00_26200) | 76031..76447 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
M5T00_RS26205 (M5T00_26205) | 76444..76674 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | senB | 1..82743 | 82743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T255720 WP_001034044.1 NZ_CP103591:c71584-71168 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |