Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4635248..4636080 | Replicon | chromosome |
| Accession | NZ_CP103589 | ||
| Organism | Escherichia coli strain 4750 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | M5T00_RS22590 | Protein ID | WP_000854753.1 |
| Coordinates | 4635706..4636080 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | M5T00_RS22585 | Protein ID | WP_001540478.1 |
| Coordinates | 4635248..4635616 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T00_RS22550 (4631081) | 4631081..4631761 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| M5T00_RS22555 (4631909) | 4631909..4632586 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| M5T00_RS22560 (4632592) | 4632592..4632825 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| M5T00_RS22565 (4632915) | 4632915..4633733 | + | 819 | WP_001773857.1 | DUF932 domain-containing protein | - |
| M5T00_RS22570 (4633824) | 4633824..4634309 | + | 486 | WP_000214398.1 | antirestriction protein | - |
| M5T00_RS22575 (4634325) | 4634325..4634801 | + | 477 | WP_001186786.1 | RadC family protein | - |
| M5T00_RS22580 (4634864) | 4634864..4635085 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| M5T00_RS22585 (4635248) | 4635248..4635616 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T00_RS22590 (4635706) | 4635706..4636080 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| M5T00_RS22595 (4636077) | 4636077..4636565 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| M5T00_RS22600 (4636577) | 4636577..4636774 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| M5T00_RS22605 (4636871) | 4636871..4637440 | + | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| M5T00_RS22610 (4638189) | 4638189..4639727 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4591243..4647540 | 56297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T255714 WP_000854753.1 NZ_CP103589:4635706-4636080 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT255714 WP_001540478.1 NZ_CP103589:4635248-4635616 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |