Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4376337..4377151 | Replicon | chromosome |
Accession | NZ_CP103589 | ||
Organism | Escherichia coli strain 4750 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M5T00_RS21250 | Protein ID | WP_001054376.1 |
Coordinates | 4376337..4376594 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | S1NWL7 |
Locus tag | M5T00_RS21255 | Protein ID | WP_001540600.1 |
Coordinates | 4376606..4377151 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T00_RS21225 (4371625) | 4371625..4372731 | + | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
M5T00_RS21230 (4372796) | 4372796..4373776 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M5T00_RS21235 (4373886) | 4373886..4374091 | + | 206 | Protein_4159 | HNH endonuclease | - |
M5T00_RS21240 (4374359) | 4374359..4375599 | - | 1241 | Protein_4160 | helicase YjhR | - |
M5T00_RS21245 (4375715) | 4375715..4375846 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M5T00_RS21250 (4376337) | 4376337..4376594 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M5T00_RS21255 (4376606) | 4376606..4377151 | + | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
M5T00_RS21260 (4377207) | 4377207..4377953 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M5T00_RS21265 (4378122) | 4378122..4378340 | + | 219 | Protein_4165 | hypothetical protein | - |
M5T00_RS21270 (4378378) | 4378378..4378494 | + | 117 | Protein_4166 | VOC family protein | - |
M5T00_RS21275 (4378739) | 4378739..4379860 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M5T00_RS21280 (4379857) | 4379857..4380135 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M5T00_RS21285 (4380147) | 4380147..4381460 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4366123..4385375 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T255713 WP_001054376.1 NZ_CP103589:4376337-4376594 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT255713 WP_001540600.1 NZ_CP103589:4376606-4377151 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|