Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4222628..4223178 Replicon chromosome
Accession NZ_CP103589
Organism Escherichia coli strain 4750

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M5T00_RS20505 Protein ID WP_001160966.1
Coordinates 4222628..4222942 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag M5T00_RS20510 Protein ID WP_000125568.1
Coordinates 4222945..4223178 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T00_RS20480 (4218303) 4218303..4219589 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5T00_RS20485 (4219589) 4219589..4220578 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5T00_RS20490 (4220575) 4220575..4221396 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5T00_RS20495 (4221399) 4221399..4221776 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5T00_RS20500 (4221783) 4221783..4222631 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5T00_RS20505 (4222628) 4222628..4222942 - 315 WP_001160966.1 CcdB family protein Toxin
M5T00_RS20510 (4222945) 4222945..4223178 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5T00_RS20515 (4223264) 4223264..4223743 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5T00_RS20520 (4223935) 4223935..4225797 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
M5T00_RS20525 (4225790) 4225790..4226320 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5T00_RS20530 (4226428) 4226428..4227759 - 1332 WP_001183207.1 MFS transporter -
M5T00_RS20535 (4227818) 4227818..4228105 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T255707 WP_001160966.1 NZ_CP103589:c4222942-4222628 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT255707 WP_000125568.1 NZ_CP103589:c4223178-4222945 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References