Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4825985..4826501 | Replicon | chromosome |
| Accession | NZ_CP103586 | ||
| Organism | Klebsiella pneumoniae strain 4737 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M5T07_RS23660 | Protein ID | WP_004178374.1 |
| Coordinates | 4825985..4826269 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | M5T07_RS23665 | Protein ID | WP_032434351.1 |
| Coordinates | 4826259..4826501 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T07_RS23635 (4821468) | 4821468..4821731 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| M5T07_RS23640 (4821861) | 4821861..4822034 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| M5T07_RS23645 (4822037) | 4822037..4822780 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5T07_RS23650 (4823137) | 4823137..4825275 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5T07_RS23655 (4825517) | 4825517..4825981 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5T07_RS23660 (4825985) | 4825985..4826269 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T07_RS23665 (4826259) | 4826259..4826501 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5T07_RS23670 (4826579) | 4826579..4828489 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5T07_RS23675 (4828512) | 4828512..4829666 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5T07_RS23680 (4829732) | 4829732..4830472 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T255689 WP_004178374.1 NZ_CP103586:c4826269-4825985 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|