Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4733257..4733960 | Replicon | chromosome |
| Accession | NZ_CP103586 | ||
| Organism | Klebsiella pneumoniae strain 4737 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | M5T07_RS23265 | Protein ID | WP_071994632.1 |
| Coordinates | 4733257..4733598 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | M5T07_RS23270 | Protein ID | WP_032434296.1 |
| Coordinates | 4733619..4733960 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T07_RS23255 (4729572) | 4729572..4730441 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
| M5T07_RS23260 (4731032) | 4731032..4733065 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
| M5T07_RS23265 (4733257) | 4733257..4733598 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| M5T07_RS23270 (4733619) | 4733619..4733960 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5T07_RS23275 (4733971) | 4733971..4734513 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| M5T07_RS23280 (4734526) | 4734526..4734966 | - | 441 | WP_032434300.1 | antirestriction protein | - |
| M5T07_RS23285 (4734997) | 4734997..4735818 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| M5T07_RS23290 (4735938) | 4735938..4736411 | - | 474 | WP_032434303.1 | hypothetical protein | - |
| M5T07_RS23295 (4736483) | 4736483..4736935 | - | 453 | WP_032410767.1 | hypothetical protein | - |
| M5T07_RS23300 (4736971) | 4736971..4737687 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| M5T07_RS23305 (4737931) | 4737931..4738805 | - | 875 | Protein_4567 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4721554..4767227 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T255688 WP_071994632.1 NZ_CP103586:c4733598-4733257 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|