Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4060885..4061504 Replicon chromosome
Accession NZ_CP103586
Organism Klebsiella pneumoniae strain 4737

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5T07_RS20050 Protein ID WP_002892050.1
Coordinates 4061286..4061504 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5T07_RS20045 Protein ID WP_002892066.1
Coordinates 4060885..4061259 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T07_RS20035 (4056037) 4056037..4057230 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5T07_RS20040 (4057253) 4057253..4060399 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M5T07_RS20045 (4060885) 4060885..4061259 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5T07_RS20050 (4061286) 4061286..4061504 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5T07_RS20055 (4061663) 4061663..4062229 + 567 WP_002892030.1 maltose O-acetyltransferase -
M5T07_RS20060 (4062201) 4062201..4062341 - 141 WP_004147370.1 hypothetical protein -
M5T07_RS20065 (4062362) 4062362..4062832 + 471 WP_002892026.1 YlaC family protein -
M5T07_RS20070 (4062807) 4062807..4064258 - 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
M5T07_RS20075 (4064359) 4064359..4065057 + 699 WP_032435564.1 GNAT family protein -
M5T07_RS20080 (4065054) 4065054..4065194 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5T07_RS20085 (4065194) 4065194..4065457 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255686 WP_002892050.1 NZ_CP103586:4061286-4061504 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT255686 WP_002892066.1 NZ_CP103586:4060885-4061259 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References